PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 487022
Common NameARALYDRAFT_487022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 404aa    MW: 42825.1 Da    PI: 9.3654
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
487022genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.23.6e-3895154362
  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
             e+alkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  487022  95 ETALKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 154
             6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3978152IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3297152IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39498152IPR003851Zinc finger, Dof-type
PROSITE patternPS013610100136IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MVFTSFPTYP DHSSNWQQQH QPITTTVGFT GNNNINQQFL PHHPLPPQPQ PQQTPPQLHH  60
NNGNGGGSGP GGPGVLIRPG SMAERARLAN IPLPETALKC PRCDSTNTKF CYFNNYSLTQ  120
PRHFCKACRR YWTRGGALRS VPVGGGCRRN KRTKNSSGGG GGGGSTSSGN SKSQDSATSN  180
DQYHHRAMAN NQMGPPSSSS SLSSLLSSYN AGLIPGHDHN NNNNNNNILG LGSSLPPLKL  240
MPPIDFTDNF TLQYGAVSAP SYHIGGGSSG GAAALLTGFD QWRFPATNQL PLGGLDPFDH  300
QMEQQNPGYG LVTGSGQYRP KNIFHNLISS SSASSAMVTA TASQLASVKM EDSNNQLNLS  360
RQLFGNEQQL WNIHGAAAAS TAAATSSWSD VSNNFSSSST SNI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937310.0AB493731.1 Arabidopsis thaliana At5g02460 mRNA for hypothetical protein, partial cds, clone: RAAt5g02460.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002873052.10.0hypothetical protein ARALYDRAFT_487022
SwissprotQ9LZ560.0DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLD7M7T30.0D7M7T3_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.6__156__AT5G02460.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-161Dof family protein